PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00166.1_g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 363aa    MW: 40597.1 Da    PI: 5.7198
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00166.1_g00019.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.2e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WTteEd++l+ +++++G g W+ I+++ g++R++k+c++rw +yl
  Rsa1.0_00166.1_g00019.1 14 KGAWTTEEDKKLISYIHEHGEGGWRDIPQKAGLKRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding47.93.1e-1567112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
  Rsa1.0_00166.1_g00019.1  67 RGEFSSEEEQIIIMLHAARGNK-WSVIARHLP-RRTDNEIKNYWNTHL 112
                              899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.586965IPR017930Myb domain
SuperFamilySSF466897.94E-2911108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002492.0E-171461IPR001005SANT/Myb domain
CDDcd001671.78E-111661No hitNo description
Gene3DG3DSA:1.10.10.605.5E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.47366116IPR017930Myb domain
SMARTSM007172.0E-1466114IPR001005SANT/Myb domain
PfamPF002491.6E-1367112IPR001005SANT/Myb domain
CDDcd001671.70E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MSRKPCCVGE GLKKGAWTTE EDKKLISYIH EHGEGGWRDI PQKAGLKRCG KSCRLRWTNY  60
LKPEIKRGEF SSEEEQIIIM LHAARGNKWS VIARHLPRRT DNEIKNYWNT HLKKRLIDQG  120
IDPVTHKPLA SNTNPTVTTT ATTQPGSLHS LDASSPDDQY PRSTSMPSMS LPISSGLNTV  180
SEITTNDGTP VKGDSLSCKK SIKKSSSTSR LLNKVAAKAT SIKDILSATT IPYGSFSNGF  240
PEQSPNEEDS SKALVDLDPF SQSLLYTEHE IHATSDLDMD QGYDFSYFLE KIGRDDHHNE  300
EHDTNVEYGH DLLMSDVSQE VSSTSVDDQG NMIGNFEGWS SYLLDHAGYM YDTDYDLLEK  360
QII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6661680.0JQ666168.1 Brassica juncea R2R3 DNA binding transcription factor MYB28-3 (MYB28-3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013621594.10.0PREDICTED: transcription factor MYB28-like
SwissprotQ9SPG20.0MYB28_ARATH; Transcription factor MYB28
TrEMBLA0A0A0RA650.0A0A0A0RA65_BRAOT; MYB28-1 transcription factor (Fragment)
STRINGBra029311.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61420.20.0myb domain protein 28